DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tpsg1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:306 Identity:73/306 - (23%)
Similarity:117/306 - (38%) Gaps:88/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSL 75
            :.|.:|:..:          |.||....|....||:.||.|:..:.||...|. ...:.||||||
  Rat     6 YCGFLLLLAV----------PGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLR-LQKVHVCGGSL 59

  Fly    76 ITDKLVLTAAHCF---IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA 137
            ::.:.||||||||   :.:......|||...|.|.    ::...::..|..:.     ..|...:
  Rat    60 LSPEWVLTAAHCFSGSVNSSDYEVHLGELTITLSP----HFSTVKQIIMYSSA-----PGPPGSS 115

  Fly   138 NDIAILRLSKSVVYRDNIRPICV------------VWDHRWRHYLDKIDLLTATGWGKTQMESDS 190
            .|||:::|:..|.....::|:|:            .|               .||||.||   :.
  Rat   116 GDIALVQLATPVALSSQVQPVCLPEASADFHPGMQCW---------------VTGWGYTQ---EG 162

  Fly   191 DALQTLDIRRQPP-------------DVCAKFI----GQTIAGNQFCAGNW-DSNLCNGDSGGPL 237
            :.|       :||             :.|::..    |..|..:..||  | ..:.|..||||||
  Rat   163 EPL-------KPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQSDMLCA--WGPGDACQDDSGGPL 218

  Fly   238 GAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFILR 280
            ...:    ...:.|.|:.|: ...|   .:..|:..|.::..:|.|
  Rat   219 VCRV----AGIWQQAGVVSW-GEGCGRPDRPGVYARVTAYVNWIHR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/269 (24%)
Tryp_SPc 45..278 CDD:238113 64/268 (24%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 65/269 (24%)
Tryp_SPc 30..260 CDD:238113 66/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.