DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss32

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:325 Identity:88/325 - (27%)
Similarity:138/325 - (42%) Gaps:59/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GIILMFQLL---------HSGCSQF-LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTD 67
            |::|..::|         .:|.|.. ||..||   :.|.:.||::|..|:....||.|.:.. ..
  Rat    15 GVLLGSEVLTTDSYSLSTQTGRSSIDLDSVCG---RPRASGRIVSGQNAQLGQWPWQVSVRE-DG 75

  Fly    68 MFVCGGSLITDKLVLTAAHCFIANQHLVA------RLGEYERTRSEECTGYYCNFREEHMVDAGF 126
            :.|||||||::..||||||||..:|||.|      .:..|......         ||...|....
  Rat    76 VHVCGGSLISEDWVLTAAHCFNQDQHLSAYTVLLGTISSYPEDNEP---------RELRAVAQYI 131

  Fly   127 KHKLYDPNTHAN-DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK---TQME 187
            |:..|....|:: |||:|:|:..:.:.|.:.|:|:   .:....||...:...||||.   .|..
  Rat   132 KYPSYSAEEHSSGDIALLQLASPISFNDYMLPVCL---PKPGDPLDPGTMCWVTGWGNIATNQPL 193

  Fly   188 SDSDALQTLDIRRQPPDVCAKF--------IGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVIT 242
            .....||.|.:.......|..:        ..|.|..:..|||  ....:.|||||||||...: 
  Rat   194 PPPFTLQELQVPLIDAKTCNTYYQENSVPSTEQVILEDMLCAGFVEGKKDACNGDSGGPLVCDV- 257

  Fly   243 HKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFILR-VWRMYGKGQTLPIPKKPPTTTRP 303
               ...::|.|:.|: ..:|   .:..|:|:|..:..:|.. :|.:..:|:..    .|..::.|
  Rat   258 ---NDVWIQAGVVSW-GSDCALSNRPGVYTNVSVYISWIQNTMWNIPTEGKNF----SPSLSSTP 314

  Fly   304  303
              Rat   315  314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/256 (29%)
Tryp_SPc 45..278 CDD:238113 72/255 (28%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 73/256 (29%)
Tryp_SPc 54..295 CDD:238113 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.