DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss42

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:280 Identity:76/280 - (27%)
Similarity:117/280 - (41%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||     :...:|:.|..|:....||.|.|. ...|.||||||:..:.|||||||..:......:
  Rat    77 CG-----QPLMKIMGGVDAEEGKWPWQVSLR-VRHMHVCGGSLLNSQWVLTAAHCIHSRVQYNVK 135

  Fly    98 LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA-NDIAILRLSKSVVYRDNIRPICV- 160
            :|:    ||.    |..|......:...|.|..:...|.. ||||:|:|.:.|.:..:|.|||| 
  Rat   136 MGD----RSV----YRQNTSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVP 192

  Fly   161 -----------VWDHRWRHYLDKIDLLTATGWGK---------TQMESDSDALQTLDIRRQPPDV 205
                       .|               .|||||         |::..:.|  |::.:..:..::
  Rat   193 TGTFHVKAGTKCW---------------VTGWGKPDPGAPQIPTEILQEVD--QSIILYEECNEM 240

  Fly   206 CAKFIGQT---IAGNQFCA---GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK 264
            ..|....:   :.....||   |..|:  |.|||||||.....:    |:||:|:.|: ...|.:
  Rat   241 LKKMASTSVDLVKRGMVCAYKEGGKDA--CQGDSGGPLSCEFDN----RWVQIGVVSW-GIGCGR 298

  Fly   265 ---ASVFTDVLSHAEFILRV 281
               ..|:|||..:.::::.|
  Rat   299 KGHPGVYTDVAFYNKWLITV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/264 (28%)
Tryp_SPc 45..278 CDD:238113 73/263 (28%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 73/263 (28%)
Tryp_SPc 84..315 CDD:238113 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.