DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Cela3b

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:288 Identity:82/288 - (28%)
Similarity:122/288 - (42%) Gaps:58/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTD---MFVCGGSLIT 77
            |:...|.|||.|         .....:.|::||..|...|.||.|.|....|   ...|||:||.
  Rat     8 LLLVALASGCGQ---------PSYNPSSRVVNGEDAVPYSWPWQVSLQYEKDGSFHHTCGGTLIA 63

  Fly    78 DKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHM--VDAG--FKHKLYDPN--TH 136
            ...|:||.||...::.....|||:||...|         ..|.:  |:||  |.|..::.|  :.
  Rat    64 PDWVMTAGHCISTSRTYQVVLGEFERGVEE---------GPEQVIPVNAGDLFVHPKWNSNCVSC 119

  Fly   137 ANDIAILRLSKSVVYRDNIRPICV-----VWDHRWRHYLDKIDLLTATGWGKTQMESD-SDALQT 195
            .||||:::||:|....|.::..|:     :..:....|:        :|||:...... .|.||.
  Rat   120 GNDIALVKLSRSAQLGDTVQLACLPPAGEILPNGAPCYI--------SGWGRLSTNGPLPDKLQQ 176

  Fly   196 LDIRRQPPDV----CAK--FIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            ..:    |.|    |:|  :.|.::.....|||....:.|||||||||.....:...|..   |:
  Rat   177 ALL----PVVDYAHCSKWDWWGFSVKKTMVCAGGDIQSGCNGDSGGPLNCPAENGTWQVH---GV 234

  Fly   255 ASYTN----RNCQKASVFTDVLSHAEFI 278
            .|:.:    ...:|.:|||.|.:..|:|
  Rat   235 TSFVSSLGCNTLKKPTVFTRVSAFNEWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/258 (29%)
Tryp_SPc 45..278 CDD:238113 74/257 (29%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 75/258 (29%)
Tryp_SPc 28..265 CDD:238113 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.