DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk1c9

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:263 Identity:70/263 - (26%)
Similarity:108/263 - (41%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            |::.|:..:.||.||.|.:..||   .|||.||....|:|||||:..|..::  ||.....:.|.
  Rat    24 RVVGGYNCETNSQPWQVAVIGTT---FCGGVLIDPSWVITAAHCYSKNYRVL--LGRNNLVKDEP 83

  Fly   109 CTGYYCNFREEHMVDAGFKHKLYDP-----------NTHANDIAILRLSKSVVYRDNIRPICVVW 162
                   |.:..:|...|:|..|.|           ..|.||:.:|.|||.......::.|.:..
  Rat    84 -------FAQRRLVSQSFQHPDYIPVFMRNHTRQRAYDHNNDLMLLHLSKPADITGGVKVIDLPT 141

  Fly   163 DHRWRHYLDKI-DLLTATGWGKT---QMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGN 223
            :.      .|: .:..|:|||.|   :|:...| ||.::|.....:.|.:...........|||.
  Rat   142 EE------PKVGSICLASGWGMTNPSEMKLSHD-LQCVNIHLLSNEKCIETYKNIETDVTLCAGE 199

  Fly   224 WD--SNLCNGDSGGPL---GAVITHKNTQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFILR 280
            .|  .:.|.|||||||   |           |..|:.|.....|.|   .:::..::....:|.:
  Rat   200 MDGGKDTCTGDSGGPLICDG-----------VLQGLTSGGATPCAKPKTPAIYAKLIKFTSWIKK 253

  Fly   281 VWR 283
            |.:
  Rat   254 VMK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/256 (27%)
Tryp_SPc 45..278 CDD:238113 67/255 (26%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.