DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk1c10

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:301 Identity:79/301 - (26%)
Similarity:118/301 - (39%) Gaps:80/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDK 79
            :::|..|..|         ||........||:.|:..:.||.||.|   :..:.::|||.||...
  Rat     4 LILFLALSLG---------GIDAAPPGQSRIVGGYKCEKNSQPWQV---AIINEYLCGGVLIDPS 56

  Fly    80 LVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP----------- 133
            .|:|||||:....|::  ||.......|.       |.:...|:..|.|..|.|           
  Rat    57 WVITAAHCYSNYYHVL--LGRNNLFEDEP-------FAQYRFVNQSFPHPDYKPFLMRNHTRQRG 112

  Fly   134 NTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT----------ATGWGKTQ--- 185
            :.::||:.:|.||:.....|.::               .|||.|          |:|||.|:   
  Rat   113 DDYSNDLMLLHLSEPADITDGVK---------------VIDLPTEEPKVGSTCLASGWGSTKPLN 162

  Fly   186 MESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWD--SNLCNGDSGGPL---GAVITHKN 245
            .|...| ||.::|.....:.|.:...|.:.....|||..|  .:.|.|||||||   |       
  Rat   163 WELPDD-LQCVNIHLLSNEKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDG------- 219

  Fly   246 TQRFVQVGIASYTNRNCQK---ASVFTDVLSHAEFILRVWR 283
                |..||.|:.|..|.:   ..|:|.::....:|..|.:
  Rat   220 ----VLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIKEVMK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/265 (27%)
Tryp_SPc 45..278 CDD:238113 71/264 (27%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 72/265 (27%)
Tryp_SPc 25..254 CDD:238113 72/267 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.