DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:256 Identity:71/256 - (27%)
Similarity:107/256 - (41%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEY------E 102
            |||:|:..|..|.||.|.| ...|...|||.|:.:..|||||||         ::|:|      :
  Rat    25 RIIDGYKCKEGSHPWQVAL-LKGDQLHCGGVLVGESWVLTAAHC---------KMGQYTVHLGSD 79

  Fly   103 RTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWR 167
            :...:..        :.......|:|..|...||.|||.::::.|.|...|.::.:.:.     .
  Rat    80 KIEDQSA--------QRIKASRSFRHPGYSTRTHVNDIMLVKMDKPVKMSDKVQKVKLP-----D 131

  Fly   168 HYLDKIDLLTATGWGKT---QMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDS--N 227
            |......|.|.:|||.|   .:...|| |...|::......|.|.....:.....|||..||  |
  Rat   132 HCEPPGTLCTVSGWGTTTSPDVTFPSD-LMCSDVKLISSQECKKVYKDLLGKTMLCAGIPDSKTN 195

  Fly   228 LCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFILRVWRMY 285
            .|||||||||   :.:...|     |:.|:....|.:.:   |:|.|..:..::....:.|
  Rat   196 TCNGDSGGPL---VCNDTLQ-----GLVSWGTYPCGQPNDPGVYTQVCKYQRWLEDTMKTY 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/247 (28%)
Tryp_SPc 45..278 CDD:238113 69/246 (28%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 70/246 (28%)
Tryp_SPc 26..244 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.