DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk11

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:77/275 - (28%)
Similarity:113/275 - (41%) Gaps:82/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            |||.|:..:.:|.||.|.|...|.: :||.:||..|.:||||||  ...|.|..|||:...:::.
  Rat    50 RIIKGYECRPHSQPWQVALFQKTRL-LCGATLIAPKWLLTAAHC--RKPHYVILLGEHNLEKTDG 111

  Fly   109 CTGYYCNFREEHMVDAGFKHKLYD---PN-THANDIAILRLSKSVVYRDNIRP-----ICVVWDH 164
            |       .:..|....|.|..::   || .|.|||.::::|........:||     :||    
  Rat   112 C-------EQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAVRPLTLSSLCV---- 165

  Fly   165 RWRHYLDKIDLLTA------TGWGKTQMESDSDALQTLDIRRQPPDV-CAKFIGQTIAGNQFCAG 222
                        ||      :|||.|    .|..|      |.|..: ||..   :|.|::.|..
  Rat   166 ------------TAGTSCLISGWGTT----SSPQL------RLPHSLRCANV---SIIGHKECER 205

  Fly   223 NWDSNL----------------CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVF 268
            .:..|:                |.|||||||   :.:.:.|     ||.|:....|   :|..|:
  Rat   206 AYPGNITDTMLCASVRKEGKDSCQGDSGGPL---VCNGSLQ-----GIISWGQDPCAVTRKPGVY 262

  Fly   269 TDVLSHAEFILRVWR 283
            |.|..:.::|..|.|
  Rat   263 TKVCKYFDWIHEVMR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/268 (28%)
Tryp_SPc 45..278 CDD:238113 73/267 (27%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 74/268 (28%)
Tryp_SPc 51..275 CDD:238113 74/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.