DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk13

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:268 Identity:74/268 - (27%)
Similarity:103/268 - (38%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SRTAYRIIN-----------GHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQ 92
            ||...:|:|           |:|...:|.||...| ......:|||.|:..|.|||||||  ...
  Rat    20 SRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAAL-LVRGRLLCGGVLVHPKWVLTAAHC--RKD 81

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPN-THAN---DIAILRLSKSVVYRD 153
            .....||::...|.|       |..:...|.....|..|..: ||.|   ||.:|.|...|...:
  Rat    82 GYTVHLGKHALGRVE-------NGEQAMEVVRSIPHPEYQVSPTHLNHDHDIMLLELKSPVQLSN 139

  Fly   154 NIRPICVVWDHRWRHYLDKIDLL-TAT-----GWGKTQMESDS--DALQTLDIRRQPPDVCAKFI 210
            ::|.:          .|...|.| |.|     |||.|.....:  ..||..:|..:..:.|.:..
  Rat   140 HVRTL----------QLSADDCLPTGTCCRVSGWGTTTSPQVNYPKTLQCANIELRSDEECRQVY 194

  Fly   211 GQTIAGNQFCAGNWD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTD 270
            ...|..|..|||..:  .:.|.|||||||  :...|      ..||.|:.:..|   .:..|:|.
  Rat   195 PGKITANMLCAGTKEGGKDSCEGDSGGPL--ICNGK------LYGIISWGDFPCGQPNRPGVYTR 251

  Fly   271 VLSHAEFI 278
            |..:..:|
  Rat   252 VSKYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 71/261 (27%)
Tryp_SPc 45..278 CDD:238113 71/260 (27%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.