DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzmm

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:261 Identity:78/261 - (29%)
Similarity:114/261 - (43%) Gaps:45/261 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF---IANQHLVARLGE 100
            :|...:||.|..|..:|.|:||.|.:|.. .||||.|:..|.|||||||.   :....||..|..
  Rat    21 NRFEAQIIGGREAVPHSRPYMVSLQNTKS-HVCGGVLVHQKWVLTAAHCLSEPLQQLKLVFGLHS 84

  Fly   101 YERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHR 165
            ....:....|.|         :....||..|:.. :.||:|:|:|...|....|::|:.:.    
  Rat    85 LHDPQDPGLTFY---------IKQAIKHPGYNLK-YENDLALLKLDGRVKPSKNVKPLALP---- 135

  Fly   166 WRHYLDKI---DLLTATGWGKTQMESD-SDALQTLDIRRQPPDVC--AKFIGQTIAGNQFC--AG 222
             |...||.   ...:..|||.|..... :.:||.||:|.....:|  ::|....:..:..|  ||
  Rat   136 -RKPRDKPAEGSRCSTAGWGITHQRGQLAKSLQELDLRLLDTRMCNNSRFWNGVLTDSMLCLKAG 199

  Fly   223 NWDSNLCNGDSGGPL----GAVITHKNTQRFVQVGIASYTNRNCQ---KASVFTDVLSHAEFILR 280
            ......|.|||||||    |.|           .||.|::::||.   |.:|.|.|..::.:|.:
  Rat   200 AKGQAPCKGDSGGPLVCGKGKV-----------DGILSFSSKNCTDIFKPTVATAVAPYSSWIRK 253

  Fly   281 V 281
            |
  Rat   254 V 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/251 (30%)
Tryp_SPc 45..278 CDD:238113 75/250 (30%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 76/253 (30%)
Trypsin 27..251 CDD:278516 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.