DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and F2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_075213.2 Gene:F2 / 29251 RGDID:61996 Length:617 Species:Rattus norvegicus


Alignment Length:302 Identity:92/302 - (30%)
Similarity:128/302 - (42%) Gaps:77/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIR----TQSRT---------AY---RIINGHTAKYNSSPWMVFL-HSTTDMFVCGGSLITDKL 80
            ||:|    .:|.|         :|   ||:.|..|:...:||.|.| ..:....:||.|||:|:.
  Rat   332 CGLRPLFEKKSLTDKTEKELLDSYIDGRIVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRW 396

  Fly    81 VLTAAHCFI--------ANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA 137
            |||||||.:        ....|:.|:|::.|||.|.      |..:..|::..:.|..|  |...
  Rat   397 VLTAAHCILYPPWDKNFTENDLLVRIGKHSRTRYER------NVEKISMLEKIYIHPRY--NWRE 453

  Fly   138 N---DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDK---IDLLTA------TGWGKTQ----- 185
            |   |||:|:|.|.|.:.|.|.|:|:.         ||   ..||.|      ||||..:     
  Rat   454 NLDRDIALLKLKKPVPFSDYIHPVCLP---------DKQTVTSLLQAGYKGRVTGWGNLRETWTT 509

  Fly   186 --MESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG-----NWDSNLCNGDSGGPLGAVITH 243
              .|.....||.:::......||.......|..|.||||     ....:.|.||||||.  |:..
  Rat   510 NINEIQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPF--VMKS 572

  Fly   244 KNTQRFVQVGIASY---TNRNCQKASVFTDVLSHAEFILRVW 282
            ....|:.|:||.|:   .:|| .|...:|.|     |.|:.|
  Rat   573 PYNHRWYQMGIVSWGEGCDRN-GKYGFYTHV-----FRLKRW 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 83/269 (31%)
Tryp_SPc 45..278 CDD:238113 82/268 (31%)
F2NP_075213.2 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
Kringle 215..292 CDD:278480
Thrombin_light 312..359 CDD:286482 6/26 (23%)
Tryp_SPc 359..608 CDD:214473 85/273 (31%)
Tryp_SPc 360..612 CDD:238113 85/274 (31%)
High affinity receptor-binding region which is also known as the TP508 peptide 547..569 9/23 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.