DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klk6

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_062048.1 Gene:Klk6 / 29245 RGDID:3419 Length:251 Species:Rattus norvegicus


Alignment Length:290 Identity:80/290 - (27%)
Similarity:128/290 - (44%) Gaps:48/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            |.|.::.|.|   :.|...|..|..|:..|             ::::|.....||.|:...|: |
  Rat     1 MPTKMLTVKT---LALCLILAKSAWSEDQD-------------KVVHGGPCLKNSHPFQAALY-T 48

  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            :...:|||.|:..:.|||||||  ...:|...||::...::|       .|:.:..||....|..
  Rat    49 SGHLLCGGVLVGPQWVLTAAHC--KKPNLEVYLGKHNLRQTE-------TFQRQISVDRTIVHPR 104

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
            |:|.||.|||.::.|.:.|.:...|:|:.:..|     ..:|.......||||.:.....|.:|.
  Rat   105 YNPQTHDNDIMMVHLKRPVKFSQRIQPLPLKKD-----CSEKNPDCQILGWGKMENGEFPDTIQC 164

  Fly   196 LDIRRQPPDVCAKFIGQTIAGNQFCAGN--WDSNLCNGDSGGPL--GAVITHKNTQRFVQVGIAS 256
            .|::....:.|.:.....|..:..|||:  ..::.|.|||||||  |..:.          ||.|
  Rat   165 ADVQLVSREECERAYPGKITRSMVCAGDKREGNDSCQGDSGGPLVCGGHLR----------GIVS 219

  Fly   257 YTNRNC---QKASVFTDVLSHAEFILRVWR 283
            :.:..|   :|..|:|||.:|..:|..:.|
  Rat   220 WGDMPCGSKEKPGVYTDVCTHIRWIQNIIR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/240 (29%)
Tryp_SPc 45..278 CDD:238113 69/239 (29%)
Klk6NP_062048.1 Tryp_SPc 28..244 CDD:214473 69/240 (29%)
Tryp_SPc 29..247 CDD:238113 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.