DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzmk

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:224 Identity:57/224 - (25%)
Similarity:96/224 - (42%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GIRTQSRTAY-RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||...|.:.: .||.|...:.:|.|:|..: ......:|||.||..:.|||||||:.........
  Rat    14 GIYMSSESFHTEIIGGREVQPHSRPFMASI-QYRGKHICGGVLIHPQWVLTAAHCYSRGHSPTVV 77

  Fly    98 LGEYERTRSEECTGYYCNFR-EEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVV 161
            ||.:..:::|....   .|. :|.:..:|||       :..|||.:::|..:.....:::.:.: 
  Rat    78 LGAHSLSKNEPMKQ---TFEIKEFIPFSGFK-------SGTNDIMLIKLRTAAELNKHVQLLHL- 131

  Fly   162 WDHRWRHYLDKIDLLTATGWGKTQME--SDSDALQTLDI--------------RRQPPDVCAKFI 210
               |.::|:........||||.|:.:  :.||.||.:.:              ..:|        
  Rat   132 ---RSKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNHKP-------- 185

  Fly   211 GQTIAGNQFCAGN--WDSNLCNGDSGGPL 237
              .|..:..|||:  .:.:.|.|||||||
  Rat   186 --VITKDMICAGDRRGEKDSCKGDSGGPL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 54/213 (25%)
Tryp_SPc 45..278 CDD:238113 54/212 (25%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 54/213 (25%)
Tryp_SPc 26..251 CDD:238113 54/212 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.