DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and F11

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:302 Identity:85/302 - (28%)
Similarity:128/302 - (42%) Gaps:68/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GVPTFVGIILMFQLLH--SGCSQF------LDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH 63
            |.||        ::||  .|.|.:      :|..|..:.:.    |:..|..:.:...||.|.||
  Rat   354 GSPT--------RILHGRGGISGYTLRLCKMDNVCTTKIRP----RVFGGAASVHGEWPWQVTLH 406

  Fly    64 STTDMFVCGGSLITDKLVLTAAHCFIANQ---HLVARLGEYERTRSEECTGYYCNFREEHMVDAG 125
             ||...:||||:|.::.:|||||||...:   .|....|...::...|.|.:   ||.:.|:   
  Rat   407 -TTQGHLCGGSIIGNRWILTAAHCFSGTETPKTLRVYGGIVNQSEINEDTTF---FRVQEMI--- 464

  Fly   126 FKHKLYDPNTHAN---DIAILRLSKSVVYRDNIRPIC--------VVWDHRWRHYLDKIDLLTAT 179
                ::|..|.|.   |||:|:|..::.|.|..||||        ||....|           .|
  Rat   465 ----IHDQYTSAESGFDIALLKLEPAMNYTDFQRPICLPSKGDRNVVHTECW-----------VT 514

  Fly   180 GWGKTQMESD-SDALQTLDIRRQPPDVC-AKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAV 240
            |||.|:...: ...||...:.....:.| .::....|.....|||  ....:.|.|||||||.. 
  Rat   515 GWGYTKSRDEVQSTLQKAKVPLVSNEECQTRYRKHKITNKVICAGYKEGGKDTCKGDSGGPLSC- 578

  Fly   241 ITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSHAEFIL 279
               |:...:..|||.|: ...|   ::..|:|:|..:.::||
  Rat   579 ---KHNGVWHLVGITSW-GEGCGQKERPGVYTNVAKYVDWIL 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/254 (29%)
Tryp_SPc 45..278 CDD:238113 73/253 (29%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519 7/27 (26%)
Tryp_SPc 387..615 CDD:214473 74/254 (29%)
Tryp_SPc 388..615 CDD:238113 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.