DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss15

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_038944148.1 Gene:Tmprss15 / 288291 RGDID:1311046 Length:1028 Species:Rattus norvegicus


Alignment Length:263 Identity:62/263 - (23%)
Similarity:114/263 - (43%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH---STTDMFVCGGSLI 76
            :::.|..|..|.:.:       ...:...:|:.|...:..:.||:|.|:   .:.|..:||.||:
  Rat   766 LILLQCNHKSCGEKM-------VTQKVGPKIVGGSDTQAGAWPWVVALYYRDRSGDRLLCGASLV 823

  Fly    77 TDKLVLTAAHCF------------IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHK 129
            :...:::||||.            :...|:.:.|...:..|              .:||....:.
  Rat   824 SSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVR--------------RVVDRIVINP 874

  Fly   130 LYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS--DA 192
            .||.....||||::.|...|.|.|.|:|||:..:::   ......:.:..|||..::.:.|  |.
  Rat   875 HYDKRRKVNDIAMMHLEFKVNYTDYIQPICLPEENQ---TFTPGRMCSIAGWGYNKINAGSTVDV 936

  Fly   193 LQTLDIRRQPPDVCAKFIGQ-TIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGI 254
            |:..|:.....:.|.:.:.: .|..:..|||  ...::.|.|||||||   :..:|.:.|: ||:
  Rat   937 LKEADVPLVSNEKCQQQLPEYDITESMLCAGYEEGGTDSCQGDSGGPL---MCQENNRWFL-VGV 997

  Fly   255 ASY 257
            .|:
  Rat   998 TSF 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/234 (25%)
Tryp_SPc 45..278 CDD:238113 59/233 (25%)
Tmprss15XP_038944148.1 SEA 54..155 CDD:214554
LDLa 188..221 CDD:238060
CUB 229..335 CDD:412131
MAM 351..507 CDD:395504
CUB 528..635 CDD:395345
LDLa 647..681 CDD:238060
Tryp_SPc 789..1025 CDD:238113 59/233 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.