DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss27

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:316 Identity:83/316 - (26%)
Similarity:123/316 - (38%) Gaps:84/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PTFVGIILMFQLLHSGC--SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVC 71
            |....::|:..||.||.  ::.: .|||   ..|...|::.|..|.....||.|.:......| |
  Rat     4 PHITALLLLPLLLRSGTEGAEAM-RACG---HPRMFNRMVGGEDALEGEWPWQVSIQRNGAHF-C 63

  Fly    72 GGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP--- 133
            |||||....||||||||               :.:.:.:.|........:...| .|.||.|   
  Rat    64 GGSLIAPTWVLTAAHCF---------------SNTSDISIYQVLLGALKLQQPG-PHALYVPVKR 112

  Fly   134 -NTH--------ANDIAILRLSKSVVYRDNIRPIC-----VVWD---HRWRHYLDKIDLLTATGW 181
             .:|        :.|:|::.|...|.:...|.|:|     ||:.   :.|           .|||
  Rat   113 VKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLPDPSVVFKSGMNCW-----------VTGW 166

  Fly   182 GKTQMESDSDALQTLDIRRQ---------------PPDVCAKFIGQTIAGNQFCAG--NWDSNLC 229
            |.   .|:.|.|....|.::               ..|..|....:||..:..|||  ....:.|
  Rat   167 GS---PSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFAEGKKDAC 228

  Fly   230 NGDSGGPLGAVITHKNTQRFVQVGIASY----TNRNCQKASVFTDVLSHAEFILRV 281
            .|||||||..::    .|.:||.|:.|:    ..||  :..|:..|.||.::|.::
  Rat   229 KGDSGGPLVCLV----DQSWVQAGVISWGEGCARRN--RPGVYIRVASHYQWIHQI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/274 (26%)
Tryp_SPc 45..278 CDD:238113 71/273 (26%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 72/274 (26%)
Tryp_SPc 39..278 CDD:238113 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.