DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and f10

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_958870.3 Gene:f10 / 282670 ZFINID:ZDB-GENE-021206-9 Length:504 Species:Danio rerio


Alignment Length:245 Identity:79/245 - (32%)
Similarity:115/245 - (46%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR--LGEYERTRS 106
            ||:||........||...|.:..:|..|||:::|:..:|:||||.  |:.|..|  :|||:....
Zfish   244 RIVNGVECPPGDCPWQALLINENNMGFCGGTILTEHFILSAAHCM--NESLSIRVVVGEYDTLVP 306

  Fly   107 E--ECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHY 169
            |  |.|         |.||....||.|.|:|:.||||:::|||.:.:...|.|.|:.........
Zfish   307 EGREAT---------HDVDEILIHKNYQPDTYHNDIALIKLSKPIKFTKYIIPACLPEMKFAERV 362

  Fly   170 LDKIDLLTATGWGKTQMES-DSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG--NWDSNLCNG 231
            |.:.|....:|:|:.:... .|..||.|.:.......|.:.....|:|..||||  ..:.:.|.|
Zfish   363 LMQQDDGLVSGFGRVREGGLSSTILQKLTVPYVNRAKCIESSNFKISGRMFCAGYDQEEKDACQG 427

  Fly   232 DSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ---KASVFTDVLSHAEFI 278
            |||||  .|...|||. |: .|:.|: ...|.   |..|:|.|..:..:|
Zfish   428 DSGGP--HVTRFKNTW-FI-TGVVSW-GEGCARKGKYGVYTQVSKYIMWI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 78/243 (32%)
Tryp_SPc 45..278 CDD:238113 77/242 (32%)
f10NP_958870.3 GLA 19..82 CDD:214503
EGF_CA 83..119 CDD:238011
FXa_inhibition 126..161 CDD:291342
Tryp_SPc 244..472 CDD:214473 78/243 (32%)
Tryp_SPc 245..474 CDD:238113 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.