DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG18420

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:343 Identity:165/343 - (48%)
Similarity:219/343 - (63%) Gaps:50/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            |...:||:.:.:.::.:|.||  |.:||||..||.|:..:...||:||..|..||||||.|||::
  Fly     1 MEIVVIGMASILLLLTVFPLL--GSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTS 63

  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            ::.|:|||:||:.:||||||||||.|..:|.|||||.|    :..||    ||||.|:..|:|:.
  Fly    64 SNQFICGGTLISRRLVLTAAHCFIPNTTIVVRLGEYNR----KLKGY----REEHQVNRTFQHRF 120

  Fly   131 YDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT 195
            |||||||||||:|||..:|||:.||||||::||..|:|::|.|.:||.||||:|:...||..|:|
  Fly   121 YDPNTHANDIALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTGTGWGRTESMHDSSELRT 185

  Fly   196 LDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR 260
            |||.|||..:||  .| ::..||||||||:||||.||:|||:||::.::|..|||||||| .||:
  Fly   186 LDISRQPSKMCA--FG-SVLSNQFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIA-ITNK 246

  Fly   261 NCQKASVFTDVLSHAEFILRVWRMYG---KGQTLPIPKKPPTTTRPPTWWHTTRIPKQTFQDYDY 322
            .||:.||||||:||.|||.|::....   :.|..|.|.|.|                        
  Fly   247 RCQRPSVFTDVMSHIEFIRRIFLTQNGNDRNQPTPKPDKEP------------------------ 287

  Fly   323 DTNHGSHWDWNYSPEWYP 340
                  .:||| :|  ||
  Fly   288 ------EFDWN-NP--YP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 137/233 (59%)
Tryp_SPc 45..278 CDD:238113 136/232 (59%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 137/233 (59%)
Tryp_SPc 43..267 CDD:238113 138/235 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463259
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.