DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG33225

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:291 Identity:95/291 - (32%)
Similarity:140/291 - (48%) Gaps:23/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALIGVPTFV---GIILMFQLL---HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFL 62
            |.|.|.|::   .|:|:..|:   ..|.|..|...||.........|::.|:.|...::||||.:
  Fly    10 AYIYVNTYIFVAEIVLLASLVLGARLGSSTLLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMV 74

  Fly    63 HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYC-NFREEHMVDAGF 126
            ....::| |.|||||...|||:|.|.::....|. ||||:|    .||...| :.|:...:|...
  Fly    75 LGENNVF-CSGSLITRLFVLTSASCLLSLPKQVI-LGEYDR----NCTSADCTSIRQVIDIDQKI 133

  Fly   127 KHKLYDPNT-HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDS 190
            .|..:...| ...|||:|||:|.|...|.:||||:..|   |.....:...||||||.|:....|
  Fly   134 IHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVD---RQVGRSVQHFTATGWGTTEWNEPS 195

  Fly   191 DALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVI------THKNTQRF 249
            ..|||:.:.:.....|...:.|.|..:|.|.|....:.|:||:||||...:      ...|..|.
  Fly   196 TILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKWNNKSRA 260

  Fly   250 VQVGIASYTNRNCQKASVFTDVLSHAEFILR 280
            ..:||.||.:.:|....|:|:|..:.::|:|
  Fly   261 FLIGIVSYGSSSCSGIGVYTNVEHYMDWIVR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 81/241 (34%)
Tryp_SPc 45..278 CDD:238113 80/240 (33%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 81/241 (34%)
Tryp_SPc 57..292 CDD:238113 82/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.