DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG33458

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster


Alignment Length:275 Identity:98/275 - (35%)
Similarity:147/275 - (53%) Gaps:7/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCG 72
            :|..:.::::...:..|.|..|:..|||   |:..|||..|..:....:||:.:|| ....|:||
  Fly     4 IPALLALLILGHGISLGYSYLLEWDCGI---SKYTYRITGGRDSPLMLNPWLAYLH-INSKFICG 64

  Fly    73 GSLITDKLVLTAAHCF-IANQHLVARLGEYERTRSEECTGYYCNFRE-EHMVDAGFKHKLYDPNT 135
            |||:....|||||||| ..|..::.||||.:.::..:|....|.... |:|:.....|.|| ...
  Fly    65 GSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY-RTA 128

  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR 200
            |..|||:.:|::.|||.|:|||||::.:..|:.|:|.|.....||||.|.....||.||...|.:
  Fly   129 HYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQ 193

  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265
            .....|..:.|..:.....|||.....:..||||||||:::.:|..:||.|.||.|:..:.....
  Fly   194 IDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGV 258

  Fly   266 SVFTDVLSHAEFILR 280
            ||||::||::.:|.|
  Fly   259 SVFTNILSYSNWIHR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 87/235 (37%)
Tryp_SPc 45..278 CDD:238113 86/234 (37%)
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 87/235 (37%)
Tryp_SPc 38..274 CDD:238113 88/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.