DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Sp212

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:117/269 - (43%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWM-VFLHSTTD--MFVCGGSLITDKLVLTAAHC 87
            ||.....|| |..|.|.: |:.|:.......||: ...|....  .|.|.||||:..:|::||||
  Fly   260 SQISSVVCG-REGSTTPF-IVRGNEFPRGQYPWLSAVYHKEVRALAFKCRGSLISSSIVISAAHC 322

  Fly    88 F--IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHAN-DIAILRLSKSV 149
            .  :....:|..||.|      :...|..:..|...|.....|..|:..:::: |||::.:.:.|
  Fly   323 VHRMTEDRVVVGLGRY------DLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPV 381

  Fly   150 VYRDNIRPICVVWDHRWRHYLDKIDLLTA--TGWGKTQMESDSDALQTLDIRRQPPDVCAK-FIG 211
            .:.|.|.|||:     |.....:....|.  .|||:.:..|.:...:.::.....|.|||. :.|
  Fly   382 TFNDIIAPICM-----WTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRG 441

  Fly   212 QTIAGNQFCAGNWD-SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNR----NCQ--KASVFT 269
            ..:.....||||.| |..|.|||||  |.::  |...|::..||.|...|    .||  :..::.
  Fly   442 TMVTERSLCAGNRDGSGPCVGDSGG--GLMV--KQGDRWLLRGIVSAGERGPAGTCQLNQYVLYC 502

  Fly   270 DVLSHAEFI 278
            |:..|..:|
  Fly   503 DLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/249 (27%)
Tryp_SPc 45..278 CDD:238113 68/248 (27%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 69/250 (28%)
Tryp_SPc 277..511 CDD:214473 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.