DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzma

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:245 Identity:68/245 - (27%)
Similarity:96/245 - (39%) Gaps:53/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCG 72
            |.:...:|.:..:...||.                 |||.|.|...:|.|:||.|....|. :|.
  Rat     9 VSSLTTVIFLLLIPEGGCE-----------------RIIGGDTVVPHSRPYMVLLKLKPDS-ICA 55

  Fly    73 GSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHA 137
            |:||....|||||||....:..|. ||.:...:..|        ::...|...:.:..:|.:||.
  Rat    56 GALIAKNWVLTAAHCIPGKKSEVI-LGAHSIKKEPE--------QQILSVKKAYPYPCFDKHTHE 111

  Fly   138 NDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLT------ATGWGKTQMES-DSDALQT 195
            .|:.:|||.|......|:..:         |...|.|.:.      ..|||:...:| .||.|:.
  Rat   112 GDLQLLRLKKKATLNKNVAIL---------HLPKKGDDVKPGTRCHVAGWGRFHNKSPPSDTLRE 167

  Fly   196 LDIRRQPPDVCAK----FIGQTIAGNQFCAGNW----DSNLCNGDSGGPL 237
            ::|......:|..    .....|..|..||||.    ||  |.|||||||
  Rat   168 VNITVIDRKICNDEKHYNFNPVIGLNMICAGNLRGGKDS--CYGDSGGPL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 64/209 (31%)
Tryp_SPc 45..278 CDD:238113 63/208 (30%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 64/209 (31%)
Tryp_SPc 29..256 CDD:238113 63/208 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.