DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss5

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:273 Identity:75/273 - (27%)
Similarity:112/273 - (41%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWM--VFLHSTTDMFVCGGSLITDKLVLTAAHC 87
            ||:     ||.|.   .|.||:.|........||.  |.|.|   ...||.|::....|:|||||
  Rat   196 CSE-----CGARP---LASRIVGGQAVASGRWPWQASVMLGS---RHTCGASVLAPYWVVTAAHC 249

  Fly    88 F-------IANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRL 145
            .       :::..:.|.|..:...|..:.|          ||:....|.||....|..|:|:|:|
  Rat   250 MYSFRLSRLSSWRVHAGLVSHSAVRQHQGT----------MVEKIIPHPLYSAQNHDYDVALLQL 304

  Fly   146 SKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQME--SDSDALQTLDIRRQPPDVC-- 206
            ...:.:.|.:..:|:  ..:.:|: .:......:|||.|...  ..||.||...:.....|:|  
  Rat   305 RTPINFSDTVSAVCL--PAKEQHF-PQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNS 366

  Fly   207 -AKFIGQTIAGNQFCAGNWD--SNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKA 265
             ..:.| .:.....|||..|  ::.|.|||||||  |....:|...  ||:.|: .|.|   .:.
  Rat   367 SCMYSG-ALTHRMLCAGYLDGRADACQGDSGGPL--VCPSGDTWHL--VGVVSW-GRGCAEPNRP 425

  Fly   266 SVFTDVLSHAEFI 278
            .|:..|   |||:
  Rat   426 GVYAKV---AEFL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/252 (27%)
Tryp_SPc 45..278 CDD:238113 67/251 (27%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 4/11 (36%)
Tryp_SPc 208..441 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.