DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:256 Identity:74/256 - (28%)
Similarity:108/256 - (42%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE 108
            :|:.|:|.:.||.|:.|.|:|  ....||||||.|:.|::||||:  ...:..||||:.      
  Rat    23 KIVGGYTCQENSVPYQVSLNS--GYHFCGGSLINDQWVVSAAHCY--KSRIQVRLGEHN------ 77

  Fly   109 CTGYYCNFRE--EHMVDAG--FKHKLYDPNTHANDIAILRLSKSVVYRDNIRPI----------- 158
                 .|..|  |..|:|.  .||..:|..|..|||.:::||..|.....:..:           
  Rat    78 -----INVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGT 137

  Fly   159 -CVVWDHRWRHYLDKIDLLTATGWGKTQME--SDSDALQTLDIRRQPPDVC-AKFIGQTIAGNQF 219
             |::                 :|||.|...  ::.|.||.||....|...| |.:.|: |..|..
  Rat   138 QCLI-----------------SGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGK-ITDNMV 184

  Fly   220 CAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFI 278
            |.|  ....:.|.||||||   |:.:...|..|..|.......|   ..|:|.|.::.::|
  Rat   185 CVGFLEGGKDSCQGDSGGP---VVCNGELQGIVSWGYGCALPDN---PGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/254 (29%)
Tryp_SPc 45..278 CDD:238113 73/253 (29%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 73/254 (29%)
Tryp_SPc 24..242 CDD:238113 74/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.