DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Klkb1

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:267 Identity:68/267 - (25%)
Similarity:111/267 - (41%) Gaps:65/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RIINGHTAKYNSSPWMVFLH--STTDMFVCGGSLITDKLVLTAAHCF--------------IANQ 92
            ||:.|..:.....||.|.|.  ..:...:||||:|..:.:|||||||              |.|.
  Rat   390 RIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNL 454

  Fly    93 HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRP 157
            ..:.....:...:             |.::     |:.|..:..:.|||:::|...:.|.:..:|
  Rat   455 SEITNKTPFSSIK-------------ELII-----HQKYKMSEGSYDIALIKLQTPLNYTEFQKP 501

  Fly   158 ICV--------VWDHRWRHYLDKIDLLTATGWGKTQMESDS-DALQTLDIRRQPPDVC-AKFIGQ 212
            ||:        ::.:.|           .||||.|:...:: :.||...|...|.:.| .|:...
  Rat   502 ICLPSKADTNTIYTNCW-----------VTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDY 555

  Fly   213 TIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVL 272
            .|.....|||..:..:  |.|||||||    ..|::.|:..|||.|: ...|   ::..|:|.|.
  Rat   556 VITKQMICAGYKEGGIDACKGDSGGPL----VCKHSGRWQLVGITSW-GEGCARKEQPGVYTKVA 615

  Fly   273 SHAEFIL 279
            .:.::||
  Rat   616 EYIDWIL 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/264 (25%)
Tryp_SPc 45..278 CDD:238113 65/263 (25%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 66/264 (25%)
Tryp_SPc 391..621 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.