DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30323

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:272 Identity:53/272 - (19%)
Similarity:81/272 - (29%) Gaps:93/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLY 131
            |...|.|||::...|:|:..|.              .||.|.......| |:...|......:|.
  Fly    50 DNHFCAGSLLSAWWVVTSGCCV--------------STRPESTPNQPSN-RKNLRVVVFTPKRLK 99

  Fly   132 DPN-----------------THANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKID----- 174
            .|:                 :...::|:|:|.:.|.            ..|:...|.:.:     
  Fly   100 KPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVT------------GQRFAMMLPEKELNSTW 152

  Fly   175 LLTATGWGK------------------------TQMESDSDALQTLDIRRQ-------PPDVCAK 208
            |..:.|||:                        |..:....:.:.:.||.|       .|| |::
  Fly   153 LCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPD-CSR 216

  Fly   209 FIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQV----GIASYTNRNCQKASVFT 269
            .:..|....:       .|:|..|.|.||..........|.|..    |...||| ..|......
  Fly   217 CLCMTSYTGR-------GNMCQQDLGSPLFCDHFLYGVARRVHTCDDEGFMFYTN-IYQNRKFIE 273

  Fly   270 DVLSHAEFILRV 281
            |.||.|.:..||
  Fly   274 DTLSGATWPKRV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 51/267 (19%)
Tryp_SPc 45..278 CDD:238113 51/267 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 47/260 (18%)
Tryp_SPc 45..272 CDD:214473 47/257 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.