DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30288

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:284 Identity:96/284 - (33%)
Similarity:144/284 - (50%) Gaps:38/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSL 75
            |:|||      .:...:.|:..||..:.:....||..|..|...|:||||.: ..:...||||||
  Fly    15 FIGII------RTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRV-MISGKAVCGGSL 72

  Fly    76 ITDKLVLTAAHCFIANQHLVARLGEYERTRSE--ECTGYYCNFREEHMVDAGFKHKLYDPNTHAN 138
            ||.:.||||.|| |:..::..|||||: ||..  :|..:.|..| .:.||...|      ..|:|
  Fly    73 ITARFVLTAEHC-ISPMYMNVRLGEYD-TRHPIFDCDDFVCTPR-AYNVDVDRK------IVHSN 128

  Fly   139 ---DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDK------IDLL--TATGWGKTQMESDSDA 192
               ||.:||:.:||::.:.:||||::        |.|      :.:|  ..||||......:.|.
  Fly   129 PGYDIGLLRMQRSVIFSNYVRPICLI--------LGKTLGGNPLSILRFNFTGWGTNSDGEEQDR 185

  Fly   193 LQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASY 257
            |||..:::.|...|.: .|:.:..:..|||::.|:.|.|||||||.|:.|.:...|..|.|:||.
  Fly   186 LQTATLQQLPQWSCER-PGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQ 249

  Fly   258 TNRNCQKASVFTDVLSHAEFILRV 281
            ..|.|....::|:|....::||.|
  Fly   250 GLRLCSGLGIYTNVTHFTDWILDV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 86/246 (35%)
Tryp_SPc 45..278 CDD:238113 85/245 (35%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 86/246 (35%)
Tryp_SPc 45..270 CDD:238113 84/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.