DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30287

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:279 Identity:96/279 - (34%)
Similarity:141/279 - (50%) Gaps:19/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLH---SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGG 73
            |.::|:..|:.   .|....|||.|.........||:|||..|...|:||||.: ....|..|||
  Fly     6 VQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVII-IERGMMKCGG 69

  Fly    74 SLITDKLVLTAAHC-FIANQHLVARLGEYERTRSEECTGYYC--NFREEHMVDAGFKHKLYDP-- 133
            ||||.:.||||||| ......|..|||:|:..::.:|:.|.|  ..||.::.      :.|.|  
  Fly    70 SLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVT------RTYVPSH 128

  Fly   134 --NTHANDIAILRLSKSVVYRDNIRPICVVW-DHRW-RHYLDKIDLLTATGWGKTQMESDSDALQ 194
              |...||||:|||..:|.|.||||.||::. |:.| .:.|..:.....||||:|:...:|..||
  Fly   129 YTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQ 193

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259
            ...:.......||:..|:.:..:..|..:...:.|.|||||||.|.:...:.:|.:..|:.||..
  Fly   194 QASLTHHHLSYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGA 258

  Fly   260 RNCQKASVFTDVLSHAEFI 278
            .:|...:|:|:|:..|.:|
  Fly   259 VHCFGPTVYTNVIHFANWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 86/242 (36%)
Tryp_SPc 45..278 CDD:238113 85/241 (35%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 86/242 (36%)
Tryp_SPc 42..280 CDD:238113 86/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.