DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30286

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:271 Identity:97/271 - (35%)
Similarity:152/271 - (56%) Gaps:10/271 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLL----HSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGS 74
            |:|:..||    |: .:|||:|.||..:......   ..|.|..:.||||.:||.:.:: ||||:
  Fly     4 ILLLTSLLPWHPHA-TAQFLEPDCGYMSPEALQN---EEHQAHISESPWMAYLHKSGEL-VCGGT 63

  Fly    75 LITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYC-NFREEHMVDAGFKHKLYDPNTHAN 138
            |:..:.:||||||...:::|..||||:....|.:|.|..| ...|:..:|..|:|..|......:
  Fly    64 LVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIH 128

  Fly   139 DIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPP 203
            ||.:|||:|||.|:.:|:|||::.:...:..::::..|.|||||::..|:.:..|:::.:.|...
  Fly   129 DIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNW 193

  Fly   204 DVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVF 268
            .||:|........:|.|..:.....|:||||||:|..|.......||||||.||.|..|...|||
  Fly   194 GVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVF 258

  Fly   269 TDVLSHAEFIL 279
            |:|:.|.::|:
  Fly   259 TNVMEHIDWIM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 85/234 (36%)
Tryp_SPc 45..278 CDD:238113 85/233 (36%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 85/230 (37%)
Tryp_SPc 39..268 CDD:214473 85/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463269
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.