DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30187

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:280 Identity:92/280 - (32%)
Similarity:136/280 - (48%) Gaps:22/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTALIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHST 65
            |.|.|..:|     ::.:.|...|.|.|||..|||    ..|.:|..||.|.:.:|.||..:|:.
  Fly     1 MQTRLAWIP-----VIFWFLKDVGASIFLDQICGI----NIALKITGGHNAAFQNSVWMAAVHNR 56

  Fly    66 TDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL 130
            |. |:|||:||..:.|||||||.:........||.|.::...:        |::  |.....|..
  Fly    57 TH-FICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDPAD--------RKD--VITAVVHSS 110

  Fly   131 YDPN-THANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQ 194
            :|.. ::.|||.:|:||..|::...|||||:|.:....:::..:....|.|||..:....||.||
  Fly   111 FDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQ 175

  Fly   195 TLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPL-GAVITHKNTQRFVQVGIASYT 258
            |:.:.....:.|...:....:..|.|||....:.|.||||||| ..|.......|.||.||.|..
  Fly   176 TIILNHLDREECYMELSVYPSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVG 240

  Fly   259 NRNCQKASVFTDVLSHAEFI 278
            ..:|....|:||::|.|::|
  Fly   241 KTSCDGQGVYTDLMSFADWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/235 (33%)
Tryp_SPc 45..278 CDD:238113 77/234 (33%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 77/235 (33%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.