DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30091

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:278 Identity:92/278 - (33%)
Similarity:141/278 - (50%) Gaps:17/278 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHS--GCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLI 76
            ::|...:|.:  |.::.||..||:..|  ...:|:.|..|....:|||..: .|.|.|:||||:|
  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQ--LIPKIVGGVDAGELKNPWMALI-KTNDEFICGGSVI 67

  Fly    77 TDKLVLTAAHCFIANQHLVAR-------LGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPN 134
            |:|.|||||||...::..:.:       ||.|...    .||.:.:..|.:.|:..:.|..:...
  Fly    68 TNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLL----ATGEHNHPHEIYNVERVYIHDSFAIQ 128

  Fly   135 THANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIR 199
            .:.||||:|||.||:||:..|:|:|::.:.:.:...|.|...||.|||.|.....|:.||.:.|.
  Fly   129 NYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIY 193

  Fly   200 RQPPDVCAKFIGQTIAGNQFCAGN-WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ 263
            |....:|......|.....||||. ...:.|..||||||...:.....:|..|:||.|....:|:
  Fly   194 RIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCR 258

  Fly   264 KASVFTDVLSHAEFILRV 281
            ...::|||:.|.:||.|:
  Fly   259 GFGMYTDVMGHIDFIERI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 81/241 (34%)
Tryp_SPc 45..278 CDD:238113 81/240 (34%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 81/241 (34%)
Tryp_SPc 37..276 CDD:238113 83/243 (34%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463347
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.