DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30083

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:298 Identity:98/298 - (32%)
Similarity:148/298 - (49%) Gaps:41/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMFQLLHSGC-SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM----FV 70
            |:..|....||..|. ||||:|.||....|.   :|::|..|:..::|||.::....|.    .|
  Fly     2 FIFTIFKIILLWPGAMSQFLEPNCGYPDISP---KIMHGQNAENGTNPWMAYIFKYNDKEVAELV 63

  Fly    71 CGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNT 135
            |||:||..:.||:||||...:|.|..||||:..:|      |:.       |...|::|.:...:
  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSR------YFA-------VTKAFRNKYFTTGS 115

  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR 200
            ::|||.|||:...|.:...|||||::.|..   .:..:....|.|||||:.|:.|..|:|:::..
  Fly   116 YSNDIGILRIQPIVKFNAVIRPICIITDPT---KVPNVKTFKAAGWGKTENETFSKVLKTVELNE 177

  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265
            .....|...:...:..:|.|||:.|.:.|.|||||||...:....:.|:||:||.|:.:..|...
  Fly   178 LNASECYNMLWVNVTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLCNSP 242

  Fly   266 SVFTDVLSHAEFIL----------------RVWRMYGK 287
            .|:|.:.|..::||                ||| .|||
  Fly   243 GVYTRLSSFIDWILMVVDNYTVRSPPKIQYRVW-PYGK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/237 (32%)
Tryp_SPc 45..278 CDD:238113 77/236 (33%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 77/237 (32%)
Tryp_SPc 34..255 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463276
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.690

Return to query results.
Submit another query.