DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CG30082

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:260 Identity:96/260 - (36%)
Similarity:146/260 - (56%) Gaps:6/260 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIA 90
            :||:||.||.........||:.|.||...|:||:.:||..:.: ||.|:|||.:.|||||||..:
  Fly    21 AQFIDPNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKNSSL-VCTGTLITKRFVLTAAHCLHS 84

  Fly    91 NQHLVARLGEYERTRSEECTGYYC-NFREEHMVDAGFKHKLYDPNTHA-NDIAILRLSKSVVYRD 153
            ...|..|||||:.:...:||..:| ...||:.|:..:.|..:.....: |||.:|:|:.:|||:.
  Fly    85 FHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKL 149

  Fly   154 NIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQ 218
            .|||||:..|.....|....:   |.||||..:.:.:..|||:::.|.....|.:.:..:::..|
  Fly   150 FIRPICLFRDPGQVPYSSTYE---AAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYGQ 211

  Fly   219 FCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWR 283
            ||||.|.::.|:|||||||...:::....|.||:||.||.:..|:...|:|.|.|...:||.:.|
  Fly   212 FCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRGPGVYTYVPSFTNWILSITR 276

  Fly   284  283
              Fly   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 87/235 (37%)
Tryp_SPc 45..278 CDD:238113 86/234 (37%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 87/235 (37%)
Tryp_SPc 40..274 CDD:238113 88/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463294
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.