DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzmn

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_694692.1 Gene:Gzmn / 245839 MGIID:2675494 Length:248 Species:Mus musculus


Alignment Length:250 Identity:78/250 - (31%)
Similarity:108/250 - (43%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWM---VFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYER 103
            |..:|.||..|.:|.|:|   |||........|||.|:.|..|||||||.  ...:...||.:..
Mouse    18 AEEVIGGHEVKPHSRPYMALVVFLKVNGIGSSCGGFLVQDYFVLTAAHCI--GSSMTVTLGAHNL 80

  Fly   104 TRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRL-SKSVVYRDNIRPICVVWDHRWR 167
            ...||.       ::...|:....|..|:|..|.|||.:|:| ||:...|| :||:.:....   
Mouse    81 RAQEET-------QQIIPVNKALPHPDYNPLDHTNDIMLLKLESKAKGTRD-VRPLKLPGPK--- 134

  Fly   168 HYLDKI---DLLTATGWGKTQMES--DSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSN 227
               ||:   |:.:..|||||.:.:  .|..|:..::..|....|.|.........:.|||  |.|
Mouse   135 ---DKVNPGDVCSVAGWGKTSINTTEGSALLEEAELIIQENKECKKQFRHYSKITEICAG--DPN 194

  Fly   228 L----CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFI 278
            .    ..|||||||  |..:|      ..|:.||.......:.|||.|:....:|
Mouse   195 KIEAPSKGDSGGPL--VCNNK------AHGVLSYVKSKKISSGVFTKVVHFLPWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/246 (31%)
Tryp_SPc 45..278 CDD:238113 76/245 (31%)
GzmnNP_694692.1 Tryp_SPc 20..241 CDD:214473 76/246 (31%)
Tryp_SPc 21..244 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.