DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Ovch2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_766496.2 Gene:Ovch2 / 244199 MGIID:3045251 Length:609 Species:Mus musculus


Alignment Length:319 Identity:80/319 - (25%)
Similarity:134/319 - (42%) Gaps:84/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGCSQFL----DPACG---IRTQSRTAY----RIINGHTAKYNSSPWMVFLHSTTD 67
            :||....|..|.|:.|    :|.||   ::.|.:..:    ||:.|...:..|.||.|.| ....
Mouse    10 LILGMVCLEQGHSETLSSIRNPDCGQSLVKPQPQNYFSLFSRIVGGSQVEKGSYPWQVSL-KQKQ 73

  Fly    68 MFVCGGSLITDKLVLTAAHCFIANQHLVARL----GEYERTRSEECTGYYCNFREEHMVDAGF-- 126
            ..:|||::|:.:.|:||||| :||:::...|    ||::.:::|  .|......|..::...|  
Mouse    74 KHICGGTIISSQWVITAAHC-MANRNIALTLNVTAGEHDLSQAE--PGEQTLAIETIIIHPQFST 135

  Fly   127 -KHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK------- 183
             |..:|       |||:|:::.:..:...:||:|:  .....|: :...:.|..|||:       
Mouse   136 RKPMIY-------DIALLKMAGTFQFGQFVRPVCL--PEPGEHF-NAGFICTTAGWGRLSEGGRL 190

  Fly   184 ------------TQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQF-CAGNWDS--NLCNGDS 233
                        ||.|.:: .|.||   :.|           |.|..| |.|:.|.  :.|.|||
Mouse   191 PQVLQQVNLPILTQEECEA-VLLTL---KNP-----------ITGKTFLCTGSPDGGRDACQGDS 240

  Fly   234 GGPLGAVITHKNTQRFVQVGIASY-------TNRNCQK-----ASVFTDVLSHAEFILR 280
            ||.|   :.......:...|:.|:       ...|.:|     ..:|||:.....:||:
Mouse   241 GGSL---MCQNRKGAWTLAGVTSWGLGCGRSWRNNARKKEQGSPGIFTDLRRVLPWILK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/274 (25%)
Tryp_SPc 45..278 CDD:238113 67/273 (25%)
Ovch2NP_766496.2 Tryp_SPc 51..294 CDD:214473 68/274 (25%)
Tryp_SPc 52..297 CDD:238113 69/277 (25%)
CUB 317..420 CDD:238001
CUB 431..542 CDD:238001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 580..609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.