DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:273 Identity:73/273 - (26%)
Similarity:117/273 - (42%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPACGIRTQ--------SRTAYRIING-HTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTA 84
            |:..||||..        |.:..||:.| .||.....||...|........||.:||::..:|||
Mouse   183 LNSRCGIRMSSSNIPLPASSSTERIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLLTA 247

  Fly    85 AHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSV 149
            ||||..|:.....:..:..|.:....        :..|.....|:.|..:|:.||||:.:|:..|
Mouse   248 AHCFWKNRDPTKWIVTFGTTITPPLV--------KRSVGKIIIHEEYHRDTNENDIALAQLTTRV 304

  Fly   150 VYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK------TQMESDSDALQTLDIRRQPPDVCAK 208
            .:.:.::.:|:. |...:  |.....:..||:|.      ||.:.....::|:.     .|||.:
Mouse   305 EFSNVVQRVCLP-DSSMK--LPPKTSVFVTGFGSIVDDGPTQNKLRQARVETIG-----SDVCNR 361

  Fly   209 ---FIGQTIAGNQFCAGNWDSNL--CNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKA 265
               :.| .|.....|||..:..:  |.|||||||    .:.|...:..|||.|: .::|   .|.
Mouse   362 KDVYDG-LITPGMLCAGFMEGKIDACKGDSGGPL----VYDNRDIWYIVGIVSW-GQSCALPNKP 420

  Fly   266 SVFTDVLSHAEFI 278
            .|:|.|..:.::|
Mouse   421 GVYTRVTKYRDWI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/248 (27%)
Tryp_SPc 45..278 CDD:238113 65/247 (26%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113
Tryp_SPc 207..436 CDD:238113 66/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.