DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss7

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_766043.3 Gene:Tmprss7 / 208171 MGIID:2686594 Length:829 Species:Mus musculus


Alignment Length:297 Identity:80/297 - (26%)
Similarity:123/297 - (41%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LMFQLLHSGCSQFLD-------PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGG 73
            :.|:..::.|...:|       ..||....|...:||:.|..::..:.||.|.||.....: ||.
Mouse   556 ICFRKQNAQCDGIVDCPDGSDEEGCGCSRSSSFLHRIVGGSDSQEGTWPWQVSLHFVGSAY-CGA 619

  Fly    74 SLITDKLVLTAAHCFIANQ-----HLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDP 133
            |:|:.:.:|:|||||..|:     ...|.||.|.:.          |.:....|.....|:.|:.
Mouse   620 SVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQG----------NAKFISPVRRIVVHEYYNS 674

  Fly   134 NTHANDIAILRLSKS--VVYRDNIRPICV------------VWDHRWRHYLDKIDLLTATGWGKT 184
            .|...|||:|:||.:  ...:..|:|||:            .|               .||||: 
Mouse   675 QTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQKVRSGEKCW---------------VTGWGR- 723

  Fly   185 QMESD---SDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHK 244
            :.|:|   |..||..::......||....| .|.....|||  :..|:.|.|||||||..  ..|
Mouse   724 RHEADSKGSPVLQQAEVELIDQTVCVSTYG-IITSRMLCAGVMSGKSDACKGDSGGPLSC--RRK 785

  Fly   245 NTQRFVQVGIASYTNRNCQKAS---VFTDVLSHAEFI 278
            :..:::..||.|: ...|.:.:   |:|.|.|...:|
Mouse   786 SDGKWILTGIVSW-GHGCGRPNFPGVYTRVSSFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/260 (28%)
Tryp_SPc 45..278 CDD:238113 72/259 (28%)
Tmprss7NP_766043.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..52
SEA 94..194 CDD:366610
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060 3/23 (13%)
Tryp_SPc 591..821 CDD:214473 73/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.