DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and PRSS55

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:311 Identity:84/311 - (27%)
Similarity:142/311 - (45%) Gaps:64/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRT--QSRTAY-RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIAN--- 91
            ||.|:  :.||.| ||..|..|:....||.|.:.:.::.| ||||::....:||||||..:.   
Human    53 CGDRSIFEGRTRYSRITGGMEAEVGEFPWQVSIQARSEPF-CGGSILNKWWILTAAHCLYSEELF 116

  Fly    92 -QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNI 155
             :.|...||      :.:.|......:|   |.:...||.:......||||:|.|:..:...|..
Human   117 PEELSVVLG------TNDLTSPSMEIKE---VASIILHKDFKRANMDNDIALLLLASPIKLDDLK 172

  Fly   156 RPICV-------VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPP-----DVCAK 208
            .|||:       .|...|           ..|||:|. .:|.::::| |:.:.|.     :.|:|
Human   173 VPICLPTQPGPATWRECW-----------VAGWGQTN-AADKNSVKT-DLMKAPMVIMDWEECSK 224

  Fly   209 FIGQTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKAS---VF 268
            ...: :..|..|||  |...:.|.|||||||  |.|.:..:::.||||.|: .::|.:.:   ::
Human   225 MFPK-LTKNMLCAGYKNESYDACKGDSGGPL--VCTPEPGEKWYQVGIISW-GKSCGEKNTPGIY 285

  Fly   269 TDVLSHAEFILRVWRMYGK-----GQTLPIPKKP--------PTTTRPPTW 306
            |.::::..:|.:|.::.|:     .:...:.:||        |....|.:|
Human   286 TSLVNYNLWIEKVTQLEGRPFNAEKRRTSVKQKPMGSPVSGVPEPGSPRSW 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/254 (28%)
Tryp_SPc 45..278 CDD:238113 69/253 (27%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 70/254 (28%)
Tryp_SPc 68..298 CDD:238113 70/256 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.