DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and ELANE

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:282 Identity:76/282 - (26%)
Similarity:121/282 - (42%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVA---RLGEYER 103
            |..|:.|..|:.::.|:||.|......| ||.:||....|::|||| :||.::.|   .||.:..
Human    27 ASEIVGGRRARPHAWPFMVSLQLRGGHF-CGATLIAPNFVMSAAHC-VANVNVRAVRVVLGAHNL 89

  Fly   104 TRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR----PICVVWDH 164
            :|.|..       |:...|...|::. |||....|||.||:|:.|.....|::    |.      
Human    90 SRREPT-------RQVFAVQRIFENG-YDPVNLLNDIVILQLNGSATINANVQVAQLPA------ 140

  Fly   165 RWRHYLDKIDLLTATGWGKT-QMESDSDALQTLDI-------RRQPPDVCAKFIGQTIAGNQFCA 221
            :.|...:.:..| |.|||.. :....:..||.|::       ||.  :||.     .:.|.|   
Human   141 QGRRLGNGVQCL-AMGWGLLGRNRGIASVLQELNVTVVTSLCRRS--NVCT-----LVRGRQ--- 194

  Fly   222 GNWDSNLCNGDSGGPL---GAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSH-AEFILRVW 282
                :.:|.||||.||   |.:  |         ||||:....| .:.::.|..:. |:|:..:.
Human   195 ----AGVCFGDSGSPLVCNGLI--H---------GIASFVRGGC-ASGLYPDAFAPVAQFVNWID 243

  Fly   283 RMYGKGQ--TLPIPKKPPTTTR 302
            .:..:.:  ..|.|:.|...:|
Human   244 SIIQRSEDNPCPHPRDPDPASR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 70/252 (28%)
Tryp_SPc 45..278 CDD:238113 70/251 (28%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 71/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.