DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006534903.1 Gene:Tmprss11a / 194597 MGIID:2684853 Length:392 Species:Mus musculus


Alignment Length:282 Identity:78/282 - (27%)
Similarity:116/282 - (41%) Gaps:80/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVAR 97
            ||.|.....|.||::|:.|...:.||.|.| ..:::..|||:||.:..|:||||||         
Mouse   149 CGKRAIPLIANRIVSGNPAAKGAWPWQVSL-QRSNIHQCGGTLIGNMWVVTAAHCF--------- 203

  Fly    98 LGEYERTRSEECTGYYCNFRE--------------EHMVDAGFKHKLYDPNTHANDIAILRLSKS 148
                 ||.|        |.|:              :..|.....|:.|.|....:|||:::.|..
Mouse   204 -----RTNS--------NPRQWTLSFGTTINPPLMKRDVRRIIMHERYRPPARDHDIALVQFSPR 255

  Fly   149 VVYRDNIRPICV------------VWDHRWRHYLDKIDLLTATGWGKTQMESDS-DALQTLDIRR 200
            |.:.|.:|.||:            |:               .||:|......:| :.|:...::.
Mouse   256 VTFSDEVRRICLPEPSASFPPNSTVY---------------ITGFGALYYGGESQNELREARVQI 305

  Fly   201 QPPDVCAK--FIGQTIAGNQFCA----GNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTN 259
            ...|:|.|  ..|..|....|||    ||:|:  |.|||||||   :...|...:..:||.|:.:
Mouse   306 ISNDICKKRHVYGNEIKRGMFCAGFLEGNYDA--CRGDSGGPL---VIRDNKDTWYLIGIVSWGD 365

  Fly   260 RNC---QKASVFTDVLSHAEFI 278
             ||   .|..|:|.|..:..:|
Mouse   366 -NCGQKNKPGVYTQVTYYRHWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 73/269 (27%)
Tryp_SPc 45..278 CDD:238113 72/268 (27%)
Tmprss11aXP_006534903.1 SEA 42..135 CDD:366610
Tryp_SPc 161..389 CDD:238113 73/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.