DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Prss8

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:286 Identity:83/286 - (29%)
Similarity:123/286 - (43%) Gaps:42/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IILMFQLLHSGC-SQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLIT 77
            |:|:..||.|.. :...:.:||...|.    ||..|.:||....||.|.: :...:.||||||::
  Rat    17 ILLLIGLLQSRIGADGTEASCGAVIQP----RITGGGSAKPGQWPWQVSI-TYNGVHVCGGSLVS 76

  Fly    78 DKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAI 142
            ::.|::||||| ..:|   ...|||..........:.|....|.|.....|..|.......|||:
  Rat    77 NQWVVSAAHCF-PREH---SKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIAL 137

  Fly   143 LRLSKSVVYRDNIRPICV-VWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQT------LDIRR 200
            :|||..|.:...|||||: ..:..:.:.|.    .|.||||..   :.|.:|||      |::..
  Rat   138 IRLSSPVTFSRYIRPICLPAANASFPNGLH----CTVTGWGHV---APSVSLQTPRPLQQLEVPL 195

  Fly   201 QPPDVCAKFIG--------QTIAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIA 255
            ...:.|:....        .||..:..|||  ....:.|.|||||||...|    ...:...||.
  Rat   196 ISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPI----DGLWYLAGIV 256

  Fly   256 SYTNRNC---QKASVFTDVLSHAEFI 278
            |:.:. |   .:..|:|...::|.:|
  Rat   257 SWGDA-CGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/253 (29%)
Tryp_SPc 45..278 CDD:238113 73/252 (29%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 74/253 (29%)
Tryp_SPc 45..284 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.