DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and T22A3.6

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:149 Identity:29/149 - (19%)
Similarity:54/149 - (36%) Gaps:43/149 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LIGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIIN-GHTAKYNSSPWMVFLHSTTDM 68
            ::.:|..:||.....|::.  |:|:.|:.....|..:....|| ||.|.: ..||:..|..|...
 Worm   200 ILDLPQLIGIFKDVDLMYE--SRFVLPSLPDGVQRLSTKSCINKGHIANH-FGPWIAVLDQTATQ 261

  Fly    69 FVCGG----------------------------SLITDKLVLTAA----HCF------IANQHLV 95
            |:...                            ::|.|:|.::..    .||      :|...|.
 Worm   262 FLAAAGRRKLRDLCFPSFNEHEIFTYQQGILLDAIIEDELTISGCTFWRRCFSSCQDDLATCWLK 326

  Fly    96 ARLGEYERTRSEECTGYYC 114
            ::.| |..:::...:|..|
 Worm   327 SQKG-YFGSKATSVSGKQC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 21/110 (19%)
Tryp_SPc 45..278 CDD:238113 21/109 (19%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.