DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Plau

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:308 Identity:81/308 - (26%)
Similarity:126/308 - (40%) Gaps:68/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGVPTFVGIILMFQLLHSGCSQFLDPACGIRTQS--------RTAYRIINGHTAKYNSSPWMVFL 62
            ||:..||.     :.:...||....|:..:..|.        |..::|:.|...:..:.||...:
Mouse   138 IGLRQFVQ-----ECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAI 197

  Fly    63 H-----STTDMFVCGGSLITDKLVLTAAHCFI---ANQHLVARLGEYERTRSEECTGYYCNFREE 119
            :     .:...|.||||||:...|.:||||||   ..::.|..||:   ::..........|..|
Mouse   198 YQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQ---SKESSYNPGEMKFEVE 259

  Fly   120 HMVDAGFKHKLY--DPNTHANDIAILRLSKSVVY----RDNIRPICVVWDHRWRHYLDKIDLLTA 178
            .::    .|:.|  |...:.||||:|::..|...    ..:|:.||:........:....::   
Mouse   260 QLI----LHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTICLPPRFTDAPFGSDCEI--- 317

  Fly   179 TGWGKTQMESDSDALQTLDIR------------RQPPDVCAKFIGQTIAGNQFCAGN--WDSNLC 229
            ||:||   ||:||.|...:::            .||     .:.|..|.....||.:  |.::.|
Mouse   318 TGFGK---ESESDYLYPKNLKMSVVKLVSHEQCMQP-----HYYGSEINYKMLCAADPEWKTDSC 374

  Fly   230 NGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC---QKASVFTDVLSH 274
            .|||||||...|..:.|..    ||.|: .|.|   .|..|:|.| ||
Mouse   375 KGDSGGPLICNIEGRPTLS----GIVSW-GRGCAEKNKPGVYTRV-SH 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 72/262 (27%)
Tryp_SPc 45..278 CDD:238113 72/261 (28%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799 4/18 (22%)
Connecting peptide 153..179 4/25 (16%)
Tryp_SPc 180..424 CDD:238113 72/261 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.