DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Plat

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus


Alignment Length:290 Identity:83/290 - (28%)
Similarity:121/290 - (41%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWM--VFL---HSTTDMFVCGGSLITDKLVL 82
            |.||     .||:|...|..:||..|......|.||.  :|:   .|..:.|:|||.||:...||
Mouse   292 SPCS-----TCGLRQYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVL 351

  Fly    83 TAAHCFIAN---QHLVARLGE-YERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAIL 143
            :|||||:..   .||...||. |.....||        .:...::....|:.:|.:|:.||||:|
Mouse   352 SAAHCFLERFPPNHLKVVLGRTYRVVPGEE--------EQTFEIEKYIVHEEFDDDTYDNDIALL 408

  Fly   144 RL---SKSVVYR-DNIRPICVV--------WDHRWRHYLDKIDLLTATGWGKTQMESD--SDALQ 194
            :|   ||..... .::...|:.        |..           ...:|:||.:..|.  ||.|:
Mouse   409 QLRSQSKQCAQESSSVGTACLPDPNLQLPDWTE-----------CELSGYGKHEASSPFFSDRLK 462

  Fly   195 TLDIRRQPPDVCAK--FIGQTIAGNQFCAGNWDS-------NLCNGDSGGPLGAVITHKNTQRFV 250
            ...:|..|...|..  ...:|:..|..|||:..|       :.|.|||||||..:|..:.|    
Mouse   463 EAHVRLYPSSRCTSQHLFNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMT---- 523

  Fly   251 QVGIASYTNRNCQK--ASVFTDVLSHAEFI 278
            ..||.|:.....||  ..|:|.|.::.::|
Mouse   524 LTGIISWGLGCGQKDVPGVYTKVTNYLDWI 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 75/267 (28%)
Tryp_SPc 45..278 CDD:238113 74/266 (28%)
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 1/2 (50%)
Tryp_SPc 311..556 CDD:238113 74/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.