DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and try-6

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001361988.1 Gene:try-6 / 185959 WormBaseID:WBGene00006624 Length:343 Species:Caenorhabditis elegans


Alignment Length:324 Identity:71/324 - (21%)
Similarity:111/324 - (34%) Gaps:122/324 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM--------FVCGGSLITDKLVLTAAHCF- 88
            ||...:|    :|.||..|:.:.:||.|.:::.|::        ..|.|:|.:.:.:|||.||. 
 Worm    33 CGKNVKS----KIFNGRKAEIDEAPWAVRINTYTNVKNIDETWSKHCSGTLTSPRHILTATHCAA 93

  Fly    89 -------------------------------IANQHLVARLGEYERTRSEECTGYYCNFREEHMV 122
                                           :|...:|.||    |.|:|  .|     |.:::.
 Worm    94 TYTETEWNGTVIDAPIYRKYCEEQSTLIVREVAASRIVVRL----RNRTE--IG-----RAKYLF 147

  Fly   123 DAGFKHKLYDPNT----HANDIAILRLSKSVVYRDNIRPICVVW---DHRWRHYLDKIDLLTATG 180
            ...:..|:.|.|.    :.:||.|:.||:.|.|...::|:||..   |:....:||..      |
 Worm   148 MFNYCRKIVDKNAYEIQYPDDIMIIELSEDVEYSSELKPVCVAGNTDDNAPNSHLDLF------G 206

  Fly   181 WGKTQMESDSDALQTL-DI-------------------RRQPPDVCAKFIGQTIAGNQFCAGNWD 225
            :|.........:|:.| ||                   |..|....||.:.:|            
 Worm   207 FGDDPPRDKPSSLKNLHDIPLKHHKVEIMDMNKEGTSKRMDPRLFIAKSVTRT------------ 259

  Fly   226 SNLCNGDSGGPLGAV-----------ITHKNTQRFV---------QVGIASYTNRNCQKASVFT 269
            |..|.||||.  |.|           :..|.|.:||         ......|.|..|:...:.|
 Worm   260 SVACPGDSGA--GGVKEIDKRTTVVGVFTKTTCKFVYRDKRDEETYASFGFYANDVCEYTGICT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/313 (22%)
Tryp_SPc 45..278 CDD:238113 68/312 (22%)
try-6NP_001361988.1 DUF316 7..320 CDD:367641 70/321 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.