DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and try-3

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:271 Identity:80/271 - (29%)
Similarity:118/271 - (43%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVGIILMFQLLHSG----CSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDM--- 68
            |:.:..:|...||.    |.:...|.        .::|||.|::.. :.:.||..|.|..|.   
 Worm     8 FLVLCFVFITKHSNAINLCEESYKPI--------FSFRIIGGNSID-DGANWMAKLVSYGDNGQG 63

  Fly    69 FVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEECTGYYCNFREEHM-VDAGFKHKLYD 132
            .:||.::|.|..::|||||.:..|           |||........|.||... |...:.|..|:
 Worm    64 ILCGATVIDDFWLVTAAHCALQLQ-----------TRSFVYVREPKNNRERSFSVKEAYIHSGYN 117

  Fly   133 PNTHANDIAILRLSKSVVYRDNIRPICVVWDHR--WRHYLDKIDLLTATGWGKTQMES------- 188
            ..|..||||:||:| |.:.:..|:|:|:|.|..  .:.|.:.:    ..|:|.|..|.       
 Worm   118 NQTADNDIALLRIS-SDLSKLGIKPVCLVHDDSKLLKQYKNGV----VIGYGLTLGEDSSGEPKL 177

  Fly   189 -DSDALQTLDIRRQPPDVCAK------FIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNT 246
             :|..||:..:.....|.|.|      .:...|.|.|.|||.:......|||||||   :.||:.
 Worm   178 INSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSGGPL---LIHKSN 239

  Fly   247 QRFVQVGIASY 257
            ..:||:||.||
 Worm   240 GEYVQIGITSY 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 74/234 (32%)
Tryp_SPc 45..278 CDD:238113 73/233 (31%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.