DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and F25E5.4

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001379698.1 Gene:F25E5.4 / 179133 WormBaseID:WBGene00017785 Length:425 Species:Caenorhabditis elegans


Alignment Length:381 Identity:89/381 - (23%)
Similarity:141/381 - (37%) Gaps:105/381 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGIILMFQLLHSGCSQFLDP--------ACGIRTQSRTAYRIINGHTAKYNSSPWMVFLH----- 63
            |.::::..|..:.|:..||.        .|||:...|   ..|||.||:....||.|.::     
 Worm     3 VSLLVLTILFTAVCAGKLDEKHNEILQLKCGIKGSQR---EFINGDTARPGDHPWAVSVYVKANT 64

  Fly    64 -STTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRSEE----CTGYYCNFREEHM-- 121
             |...:|:..|:||:.:.|||.....:.:       |:......||    |.|.:....::.|  
 Worm    65 TSKNGVFLGPGTLISARHVLTFNSIKVVD-------GKRRILGQEEVNGACNGNHFELSQDEMYH 122

  Fly   122 VDAGFKH-KLYD-----PNTHAN--------------DIAILRLSKSVVYRDNIRPICVVWDHRW 166
            .|..|:| |.:|     .||.|:              .:.:..|.:|.::.....|:|:  .:..
 Worm   123 FDYDFEHFKNFDSKRDFKNTIASVYIINGCQSSPPPATLLMFELKESALHNKKGYPVCI--SNSP 185

  Fly   167 RHYLDKIDLLTATGWGKTQM-ESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCN 230
            :|: |..|...   :|..|. ...|.|....:.....|..||..:.|    ||        .||:
 Worm   186 KHF-DASDFEV---FGLNQQGRLVSGAFAPTNCTATAPFSCAHAVKQ----NQ--------GLCS 234

  Fly   231 GDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ------KASVFTDVLSHAEFILRVWRMYGKGQ 289
            ||.||  .||....|  ||..:|..:..|:||:      :|..|.::..:.|.|..|     .|.
 Worm   235 GDFGG--SAVSRIDN--RFTMLGFFAQGNKNCKAKPETLEAFKFLNIGYYREEICEV-----TGI 290

  Fly   290 TLPIPKKP--------------PTTTRPPTWWHTTRIPKQT-----FQDYDYDTNH 326
            ..|.|..|              .:|..||:  ..|.:|:.|     |.:....|:|
 Worm   291 CTPSPPSPEESTTLSPSELIPGESTDTPPS--SKTDVPEGTTEQEFFTEGPASTDH 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 65/272 (24%)
Tryp_SPc 45..278 CDD:238113 65/271 (24%)
F25E5.4NP_001379698.1 DUF316 5..291 CDD:367641 76/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.