DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Masp2

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001003893.1 Gene:Masp2 / 17175 MGIID:1330832 Length:685 Species:Mus musculus


Alignment Length:265 Identity:82/265 - (30%)
Similarity:116/265 - (43%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF----IA 90
            :|.||:.|.: ...||:.|..||....||.|.|...|.  ...|:||.|..||||||..    :|
Mouse   430 EPVCGLSTHT-IGGRIVGGQPAKPGDFPWQVLLLGQTT--AAAGALIHDNWVLTAAHAVYEKRMA 491

  Fly    91 NQHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKL-YDPNTHANDIAILRLSKSVVYRDN 154
            ...|..|:|..:|....    |...:.||..:..|:.|.. :|     ||||:::|...|....:
Mouse   492 ASSLNIRMGILKRLSPH----YTQAWPEEIFIHEGYTHGAGFD-----NDIALIKLKNKVTINGS 547

  Fly   155 IRPICVVWDHRWRHYLDKIDLL-TATGWGKTQMESDSDALQTLDIRRQPPDVCAK-----FIGQT 213
            |.|:|:  ..:....|.:.|.. |..|||.||....:..|..:||.......|..     :.|..
Mouse   548 IMPVCL--PRKEAASLMRTDFTGTVAGWGLTQKGLLARNLMFVDIPIADHQKCTAVYEKLYPGVR 610

  Fly   214 IAGNQFCAG--NWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA---SVFTDVLS 273
            ::.|..|||  ....:.|.|||||.|  |.....|||:...||.|:.:.||..|   .|:|.|::
Mouse   611 VSANMLCAGLETGGKDSCRGDSGGAL--VFLDNETQRWFVGGIVSWGSINCGAADQYGVYTKVIN 673

  Fly   274 HAEFI 278
            :..:|
Mouse   674 YIPWI 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 77/249 (31%)
Tryp_SPc 45..278 CDD:238113 76/248 (31%)
Masp2NP_001003893.1 CUB 19..136 CDD:238001
FXa_inhibition 152..180 CDD:291342
CUB 184..293 CDD:278839
Sushi 300..361 CDD:278512
Sushi 366..429 CDD:278512
Tryp_SPc 443..678 CDD:214473 77/249 (31%)
Tryp_SPc 444..681 CDD:238113 77/250 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.