DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and Gzmc

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_599159.1 Gene:Gzmc / 171290 RGDID:620019 Length:248 Species:Rattus norvegicus


Alignment Length:251 Identity:71/251 - (28%)
Similarity:112/251 - (44%) Gaps:31/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AYRIINGHTAKYNSSPWMV---FLHSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYER 103
            |..||.|:....:|.|:|.   ||:.......|||.|:.|..|||||||  ..:.:...||.: .
  Rat    18 AEEIIGGNEVSPHSRPYMAYFEFLNDNGKKTFCGGFLVRDNFVLTAAHC--RGRSMTVTLGAH-N 79

  Fly   104 TRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRH 168
            .:::|.|      ::...|.....|..|:|:..:|||.:|:|.:|......:||:.:   .|...
  Rat    80 IKAKEKT------QQIIPVANATPHPAYNPDKRSNDIMLLKLVRSAKRTSAVRPLNL---PRRNA 135

  Fly   169 YLDKIDLLTATGWGKTQMESD-SDALQTLDIRRQPPDVC-AKFIGQTIAGNQFCAGNWDSNLCNG 231
            ::...|:....||||...:.: .:.|:.:::..|...|| ::|....|..::.|.|  ||.....
  Rat   136 HVKPGDVCYMAGWGKITPQGEFPNTLREVELTVQKDRVCESQFQRSYIKASEICVG--DSKTKGA 198

  Fly   232 ----DSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKASVFTDVLSHAEFILRVWR 283
                ||||||   :..|     ...||.||...:.....|||.|||...:|.:..:
  Rat   199 SFEEDSGGPL---VCKK-----AAAGIVSYGKTDGSAPQVFTRVLSFLSWIKKTMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 69/242 (29%)
Tryp_SPc 45..278 CDD:238113 69/241 (29%)
GzmcNP_599159.1 Tryp_SPc 20..241 CDD:214473 69/242 (29%)
Tryp_SPc 21..244 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.