DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18636 and CFD

DIOPT Version :9

Sequence 1:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:274 Identity:71/274 - (25%)
Similarity:111/274 - (40%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ACGIRTQSRTA---YRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHCF--IAN 91
            |||....:..|   .||:.|..|:.::.|:|..: ......:|||.|:.::.||:||||.  .|:
Human    17 ACGEEAWAWAAPPRGRILGGREAEAHARPYMASV-QLNGAHLCGGVLVAEQWVLSAAHCLEDAAD 80

  Fly    92 QHLVARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIR 156
            ..:...||.:..::.|.....|...|       ...|....|:|..:|:.:|:||:.......:|
Human    81 GKVQVLLGAHSLSQPEPSKRLYDVLR-------AVPHPDSQPDTIDHDLLLLQLSEKATLGPAVR 138

  Fly   157 PICVVWDHRWRHYLDKID-------LLTATGWG-KTQMESDSDALQ-----TLD----IRRQPPD 204
            |:      .|:    ::|       |....||| ........|:||     .||    .||...|
Human   139 PL------PWQ----RVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHD 193

  Fly   205 VCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPL--GAVITHKNTQRFVQVGIASYTNRNC---QK 264
                   ..|.....||.:...:.|.|||||||  |.|:.          |:.:..:|.|   :|
Human   194 -------GAITERLMCAESNRRDSCKGDSGGPLVCGGVLE----------GVVTSGSRVCGNRKK 241

  Fly   265 ASVFTDVLSHAEFI 278
            ..::|.|.|:|.:|
Human   242 PGIYTRVASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 66/257 (26%)
Tryp_SPc 45..278 CDD:238113 65/256 (25%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 66/257 (26%)
Tryp_SPc 33..258 CDD:238113 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.